peptides.py is a pure-Python package to compute common descriptors for protein sequences

Related tags

Data Analysispeptides.py
Overview

peptides.py Stars

Physicochemical properties and indices for amino-acid sequences.

Actions Coverage PyPI Wheel Python Versions Python Implementations License Source Mirror GitHub issues Changelog Downloads

🗺️ Overview

peptides.py is a pure-Python package to compute common descriptors for protein sequences. It is a port of Peptides, the R package written by Daniel Osorio for the same purpose. This library has no external dependency and is available for all modern Python versions (3.6+).

🔧 Installing

Install the peptides package directly from PyPi which hosts universal wheels that can be installed with pip:

$ pip install peptides

💡 Example

Start by creating a Peptide object from a protein sequence:

>>> import peptides
>>> peptide = peptides.Peptide("MLKKRFLGALAVATLLTLSFGTPVMAQSGSAVFTNEGVTPFAISYPGGGT")

Then use the appropriate methods to compute the descriptors you want:

>>> peptide.aliphatic_index()
89.8...
>>> peptide.boman()
-0.2097...
>>> peptide.charge(pH=7.4)
1.99199...
>>> peptide.isoelectric_point()
10.2436...

Methods that return more than one scalar value (for instance, Peptide.blosum_indices) will return a dedicated named tuple:

>>> peptide.ms_whim_scores()
MSWHIMScores(mswhim1=-0.436399..., mswhim2=0.4916..., mswhim3=-0.49200...)

Use the Peptide.descriptors method to get a dictionary with every available descriptor. This makes it very easy to create a pandas.DataFrame with descriptors for several protein sequences:

>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ]) >>> df BLOSUM1 BLOSUM2 BLOSUM3 BLOSUM4 ... Z2 Z3 Z4 Z5 0 0.367000 -0.436000 -0.239 0.014500 ... -0.711000 -0.104500 -1.486500 0.429500 1 -0.697500 -0.372500 -0.493 0.157000 ... -0.307500 -0.627500 -0.450500 0.362000 2 0.479333 -0.001333 0.138 0.228667 ... -0.299333 0.465333 -0.976667 0.023333 [3 rows x 66 columns] "> 
>>> seqs = ["SDKEVDEVDAALSDLEITLE", "ARQQNLFINFCLILIFLLLI", "EGVNDNECEGFFSAR"]
>>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ])
>>> df
    BLOSUM1   BLOSUM2  BLOSUM3   BLOSUM4  ...        Z2        Z3        Z4        Z5
0  0.367000 -0.436000   -0.239  0.014500  ... -0.711000 -0.104500 -1.486500  0.429500
1 -0.697500 -0.372500   -0.493  0.157000  ... -0.307500 -0.627500 -0.450500  0.362000
2  0.479333 -0.001333    0.138  0.228667  ... -0.299333  0.465333 -0.976667  0.023333

[3 rows x 66 columns]

💭 Feedback

⚠️ Issue Tracker

Found a bug ? Have an enhancement request ? Head over to the GitHub issue tracker if you need to report or ask something. If you are filing in on a bug, please include as much information as you can about the issue, and try to recreate the same bug in a simple, easily reproducible situation.

🏗️ Contributing

Contributions are more than welcome! See CONTRIBUTING.md for more details.

⚖️ License

This library is provided under the GNU General Public License v3.0. The original R Peptides package was written by Daniel Osorio, Paola Rondón-Villarreal and Rodrigo Torres, and is licensed under the terms of the GPLv2.

This project is in no way not affiliated, sponsored, or otherwise endorsed by the original Peptides authors. It was developed by Martin Larralde during his PhD project at the European Molecular Biology Laboratory in the Zeller team.

You might also like...
Python Package for DataHerb: create, search, and load datasets.
Python Package for DataHerb: create, search, and load datasets.

The Python Package for DataHerb A DataHerb Core Service to Create and Load Datasets.

DataHerb 4 Feb 11, 2022
wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information
wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information

Python based Wikidata framework for easy dataframe extraction wikirepo is a Python package that provides a framework to easily source and leverage sta

Andrew Tavis McAllister 35 Jan 4, 2023
Python package for processing UC module spectral data.

UC Module Python Package How To Install clone repo. cd UC-module pip install . How to Use uc.module.UC(measurment=str, dark=str, reference=str, heade

Nicolai Haaber Junge 1 Oct 20, 2021
sportsdataverse python package
sportsdataverse python package

sportsdataverse-py See CHANGELOG.md for details. The goal of sportsdataverse-py is to provide the community with a python package for working with spo

Saiem Gilani 37 Dec 27, 2022
PyEmits, a python package for easy manipulation in time-series data.
PyEmits, a python package for easy manipulation in time-series data.

PyEmits, a python package for easy manipulation in time-series data. Time-series data is very common in real life. Engineering FSI industry (Financial

Thompson 5 Sep 23, 2022
Retail-Sim is python package to easily create synthetic dataset of retaile store.

Retailer's Sale Data Simulation Retail-Sim is python package to easily create synthetic dataset of retaile store. Simulation Model Simulator consists

Corca AI 7 Sep 30, 2022
A python package which can be pip installed to perform statistics and visualize binomial and gaussian distributions of the dataset

GBiStat package A python package to assist programmers with data analysis. This package could be used to plot : Binomial Distribution of the dataset p

Rishikesh S 4 Oct 17, 2022
VevestaX is an open source Python package for ML Engineers and Data Scientists.
VevestaX is an open source Python package for ML Engineers and Data Scientists.

VevestaX Track failed and successful experiments as well as features. VevestaX is an open source Python package for ML Engineers and Data Scientists.

Vevesta 24 Dec 14, 2022
nrgpy is the Python package for processing NRG Data Files

nrgpy nrgpy is the Python package for processing NRG Data Files Website and source: https://github.com/nrgpy/nrgpy Documentation: https://nrgpy.github

NRG Tech Services 23 Dec 8, 2022
Comments
  • Per-residue data

    Per-residue data

    It seems that the API can only output single statistics for the entire peptide chain, but I'm interested in statistics for each residue individually. I'm wondering if it might be possible to output an array/list from some of these functions instead of always averaging them as is done now.

    enhancement 
    opened by multimeric 1
  • Hydrophobic moment is inconsistent with R version

    Hydrophobic moment is inconsistent with R version

    Computed hydrophobic moment is not the same as the one computed by R. More specifically, it seems that peptides.py always outputs 0 for the hydrophobic moment when peptide length is shorter than the set window. The returned value matches the value from R when peptide length is equal to or greater than the set window length.

    Example in python:

    >>> import peptides`
>>> peptides.Peptide("MLK").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("AACQ").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("FGGIQ").hydrophobic_moment(window=5, angle=100)
0.31847187610377536

    Example in R:

    > library(Peptides)
> hmoment(seq="MLK", window=5, angle=100)
[1] 0.8099386
> hmoment(seq="AACQ", window=5, angle=100)
[1] 0.3152961
> hmoment(seq="FGGIQ", window=5, angle=100)
[1] 0.3184719

    I think that it can be easily fixed by internally setting the window length to the length of the peptide if the latter is shorter. What I propose:

    --- a/peptides/__init__.py
+++ b/peptides/__init__.py
@@ -657,6 +657,7 @@ class Peptide(typing.Sequence[str]):
               :doi:`10.1073/pnas.81.1.140`. :pmid:`6582470`.

         """
+        window = min(window, len(self))
         scale = tables.HYDROPHOBICITY["Eisenberg"]
         lut = [scale.get(aa, 0.0) for aa in self._CODE1]
         angles = [(angle * i) % 360 for i in range(window)]
    bug 
    opened by eotovic 1
  • RuntimeWarning in auto_correlation function()

    RuntimeWarning in auto_correlation function()

    Hi, thank you for creating peptides.py.

    Some hydrophobicity tables together with certain proteins cause a runtime warning for in the function auto_correlation():

    import peptides

for hydro in peptides.tables.HYDROPHOBICITY.keys():
    print(hydro)
    table = peptides.tables.HYDROPHOBICITY[hydro]
    peptides.Peptide('MANTQNISIWWWAR').auto_correlation(table)

    Warning (s2 == 0):

    RuntimeWarning: invalid value encountered in double_scalars
  return s1 / s2

    The tables concerned are: octanolScale_pH2, interfaceScale_pH2, oiScale_pH2 Some other proteins causing the same warning: ['MSYGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGYGY', 'MFILLIIIGASCFGGGGGCGYGGYGGYAGGYGGYCC', 'MSFGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGGF']

    opened by jhahnfeld 0
Releases(v0.3.1)

  • v0.3.1(Sep 1, 2022)

  • v0.3.0(Sep 1, 2022)

    Added

    • Peptide.linker_preference_profile to build a profile like used in the DomCut method from Suyama & Ohara (2002).
    • Peptide.profile to build a generic per-residue profile from a data table (#3).
    Source code(tar.gz)
    Source code(zip)

  • v0.2.0(Oct 25, 2021)

    Added

    • Peptide.counts method to get the number of occurences of each amino acid in the peptide.
    • Peptide.frequencies to get the frequencies of each amino acid in the peptide.
    • Peptide.pcp_descriptors to compute the PCP descriptors from Mathura & Braun (2001).
    • Peptide.sneath_vectors to compute the descriptors from Sneath (1966).
    • Hydrophilicity descriptors from Barley (2018).
    • Peptide.structural_class to predict the structural class of a protein using one of three reference datasets and one of four distance metrics.

    Changed

    • Peptide.aliphatic_index now supports unknown Leu/Ile residue (code J).
    • Swap order of Peptide.hydrophobic_moment arguments for consistency with profile methods.
    • Some Peptide functions now support vectorized code using numpy if available.
    Source code(tar.gz)
    Source code(zip)

  • v0.1.0(Oct 21, 2021)

Owner
Martin Larralde
PhD candidate in Bioinformatics, passionate about programming, Pythonista, Rustacean. I write poems, and sometimes they are executable.
Martin Larralde
GitHub Repository
My first Python project is a simple Mad Libs program.

Python CLI Mad Libs Game My first Python project is a simple Mad Libs program. Mad Libs is a phrasal template word game created by Leonard Stern and R

Carson Johnson 1 Dec 10, 2021
An extension to pandas dataframes describe function.

pandas_summary An extension to pandas dataframes describe function. The module contains DataFrameSummary object that extend describe() with: propertie

Mourad 450 Dec 30, 2022
Mortgage-loan-prediction - Show how to perform advanced Analytics and Machine Learning in Python using a full complement of PyData utilities

Mortgage-loan-prediction - Show how to perform advanced Analytics and Machine Learning in Python using a full complement of PyData utilities. This is aimed at those looking to get into the field of D

Joachim 1 Dec 26, 2021
A Python package for the mathematical modeling of infectious diseases via compartmental models

A Python package for the mathematical modeling of infectious diseases via compartmental models. Originally designed for epidemiologists, epispot can be adapted for almost any type of modeling scenari

epispot 12 Dec 28, 2022
A stock analysis app with streamlit

StockAnalysisApp A stock analysis app with streamlit. You select the ticker of the stock and the app makes a series of analysis by using the price cha

Antonio Catalano 50 Nov 27, 2022
A real data analysis and modeling project - restaurant inspections

A real data analysis and modeling project - restaurant inspections Jafar Pourbemany 9/27/2021 This project represents data analysis and modeling of re

Jafar Pourbemany 2 Aug 21, 2022
Statistical Rethinking course winter 2022

Statistical Rethinking (2022 Edition) Instructor: Richard McElreath Lectures: Uploaded Playlist and pre-recorded, two per week Discussion: Online, F

Richard McElreath 3.9k Dec 31, 2022
Analyzing Covid-19 Outbreaks in Ontario

My group and I took Covid-19 outbreak statistics from ontario, and analyzed them to find different patterns and future predictions for the virus

Vishwaajeeth Kamalakkannan 0 Jan 20, 2022
A program that uses an API and a AI model to get info of sotcks

Stock-Market-AI-Analysis I dont mind anyone using this code but please give me credit A program that uses an API and a AI model to get info of stocks

1 Dec 17, 2021
Data Intelligence Applications - Online Product Advertising and Pricing with Context Generation

Data Intelligence Applications - Online Product Advertising and Pricing with Context Generation Overview Consider the scenario in which advertisement

Manuel Bressan 2 Nov 18, 2021
Template for a Dataflow Flex Template in Python

Dataflow Flex Template in Python This repository contains a template for a Dataflow Flex Template written in Python that can easily be used to build D

STOIX 5 Apr 28, 2022
Display the behaviour of a realtime program with a scope or logic analyser.

1. A monitor for realtime MicroPython code This library provides a means of examining the behaviour of a running system. It was initially designed to

Peter Hinch 17 Dec 05, 2022
Pipeline and Dataset helpers for complex algorithm evaluation.

tpcp - Tiny Pipelines for Complex Problems A generic way to build object-oriented datasets and algorithm pipelines and tools to evaluate them pip inst

Machine Learning and Data Analytics Lab FAU 3 Dec 07, 2022
Useful tool for inserting DataFrames into the Excel sheet.

PyCellFrame Insert Pandas DataFrames into the Excel sheet with a bunch of conditions Install pip install pycellframe Usage Examples Let's suppose that

Luka Sosiashvili 1 Feb 16, 2022
Port of dplyr and other related R packages in python, using pipda.

Unlike other similar packages in python that just mimic the piping syntax, datar follows the API designs from the original packages as much as possible, and is tested thoroughly with the cases from t

179 Dec 21, 2022
Statistical Rethinking: A Bayesian Course Using CmdStanPy and Plotnine

Statistical Rethinking: A Bayesian Course Using CmdStanPy and Plotnine Intro This repo contains the python/stan version of the Statistical Rethinking

Andrés Suárez 3 Nov 08, 2022
Validated, scalable, community developed variant calling, RNA-seq and small RNA analysis

Validated, scalable, community developed variant calling, RNA-seq and small RNA analysis. You write a high level configuration file specifying your in

Blue Collar Bioinformatics 917 Jan 03, 2023
Vectorizers for a range of different data types

Vectorizers for a range of different data types

Tutte Institute for Mathematics and Computing 69 Dec 29, 2022
EOD Historical Data Python Library (Unofficial)

EOD Historical Data Python Library (Unofficial) https://eodhistoricaldata.com Installation python3 -m pip install eodhistoricaldata Note Demo API key

Michael Whittle 20 Dec 22, 2022
Code for the DH project "Dhimmis & Muslims – Analysing Multireligious Spaces in the Medieval Muslim World"

Damast This repository contains code developed for the digital humanities project "Dhimmis & Muslims – Analysing Multireligious Spaces in the Medieval

University of Stuttgart Visualization Research Center 2 Jul 01, 2022